PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G039300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 271aa    MW: 30076.6 Da    PI: 4.9457
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G039300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l++ + ++G g+W+++++  g++R++k+c++rw +yl
  Brast08G039300.1.p 14 KGLWSPEEDEKLYNHIIRHGVGCWSSVPKLAGLHRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding521.6e-1667110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++ +E+el+v +++ lG++ W+ Ia++++ gRt++++k++w++
  Brast08G039300.1.p  67 RGSFSLQEEELIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNS 110
                         899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.502961IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-23964IPR009057Homeodomain-like
SuperFamilySSF466894.49E-2912108IPR009057Homeodomain-like
SMARTSM007179.6E-141363IPR001005SANT/Myb domain
PfamPF002497.0E-151461IPR001005SANT/Myb domain
CDDcd001678.35E-121761No hitNo description
PROSITE profilePS5129425.10362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2565116IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1467110IPR001005SANT/Myb domain
CDDcd001671.00E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRLPCGGEA KLRKGLWSPE EDEKLYNHII RHGVGCWSSV PKLAGLHRCG KSCRLRWINY  60
LRPDLKRGSF SLQEEELIVA LHEILGNRWS QIASHLPGRT DNEIKNFWNS SLKKKLRQRG  120
IDPATHKPIA AMPSEAQEDE DQKPSTGAGA MDGVLAPKQQ AVFDPFPAAA TDFGGVFDHD  180
GLAAPALFEA AGDYSCSVLD LDSCYGESSS NSSNNNNWNS NVLDTEAMHW APIKDDEDED  240
DAALGEHKFF MLPCQEQMSL PHFDFNLEYF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
1h8a_C1e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794201e-154HF679420.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB14 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567975.11e-149PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-97MYB3_HORVU; Myb-related protein Hv33
TrEMBLI1HGY81e-149I1HGY8_BRADI; Uncharacterized protein
STRINGBRADI2G17982.11e-148(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-75myb domain protein 61